Chlorotoxin | 163515-35-3

A (265 species)

Adrenocorticotropic hormone Adrenomedullin Adrenorphin Angiotensin Adipokinetic Hormone AGRP Aquaporin-2 Allatostatin ANP Atriopeptin Antioxidant Antho-Rfamide Apelin Amylin Amyloid

B (44 species)

BNP Bradykinin

C (134 species)

CRF CGRP CCAP C-Reactive Protein C-Peptide CEA Cholecystokinin Cortistatin Conotoxin Cardiotoxin Calcitonin Casomorphin CREBtide Ceruletide CEF

D (42 species)

Deltorphin Dynorphin

E (116 species)

Exendin EGF Endomorphin Endorphin Endothelin Enkephalin Enterostatin Endokinin

F (25 species)

FGF Fibrinogen Fibrinopeptide Fibronectin Flu

G (123 species)

GM-CSF Gn-RH GHRP Glucagon Gp100 GPC3 Galanin GIP Gastrin Ghrelin Guanylin GAP

H (67 species)

HIV HCG Hypercalcemia Malignancy Factor HGH Hepatitis/HBV Histatin Helospectin

I (62 species)

IGF Insulin Inhibitor Influenza IL

K (13 species)

Kinase

L (45 species)

Laminin Leucokinin LH-RH Lipotropin LL - 37 Leptin

M (76 species)

MCH Melanocyte Protein Magainin MAGE MART-1 Mastoparan Myelin

N (115 species)

Neurotrophic factor Neuromedin Neurokinin Neuropeptide Natriuretic peptide

O (773 species)

Obestatin OVA Oxytocin Orexin Others

P (129 species)

PACAP pTH Protease Activated Receptor Parathyroid Hormone PLP Procathepsin Pannexin Peptide YY Prolactin Pancreatic Polypeptide Probe

R (61 species)

RF amide Receptor RGD

S (187 species)

Substance P Salusin Saposin Sarafotoxin Secretin Somatostatin Substrate SH2 Domain Ligand

T (43 species)

TRH TNF Toxin B Tyrosinase Terlipressin

U (35 species)

Urocortin Urotensin

V (44 species)

VIP Vasopressin Valorphin

W (3 species)

Wwamide

X (3 species)

Xenopsin

Name Chlorotoxin	Molecular structural formula
Purity 95%
CAS Number 163515-35-3
Formula C158H249N53O47S11
MW 3995.71
Target Chloride Channel
Sequence Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2(Disulfide Bridge:Cys2-Cys19 & Cys5-Cys28 & Cys16-Cys33 & Cys20-Cys35)
Sequence Shortening MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2(Disulfide Bridge:C2-C19 & C5-C28 & C16-C33 & C20-C35)
InChIKey QPAKKWCQMHUHNI-UHFFFAOYSA-N
References [1].Chlorotoxin: Structure, activity, and potential uses in cancer therapy. [2]. Purification and characterization of chlorotoxin, a chloride channel ligand from the venom of the scorpion.