Calcitonin, eel | 57014-02-5

A (265 species)

Adrenocorticotropic hormone Adrenomedullin Adrenorphin Angiotensin Adipokinetic Hormone AGRP Aquaporin-2 Allatostatin ANP Atriopeptin Antioxidant Antho-Rfamide Apelin Amylin Amyloid

B (44 species)

BNP Bradykinin

C (134 species)

CRF CGRP CCAP C-Reactive Protein C-Peptide CEA Cholecystokinin Cortistatin Conotoxin Cardiotoxin Calcitonin Casomorphin CREBtide Ceruletide CEF

D (42 species)

Deltorphin Dynorphin

E (116 species)

Exendin EGF Endomorphin Endorphin Endothelin Enkephalin Enterostatin Endokinin

F (25 species)

FGF Fibrinogen Fibrinopeptide Fibronectin Flu

G (123 species)

GM-CSF Gn-RH GHRP Glucagon Gp100 GPC3 Galanin GIP Gastrin Ghrelin Guanylin GAP

H (67 species)

HIV HCG Hypercalcemia Malignancy Factor HGH Hepatitis/HBV Histatin Helospectin

I (62 species)

IGF Insulin Inhibitor Influenza IL

K (13 species)

Kinase

L (45 species)

Laminin Leucokinin LH-RH Lipotropin LL - 37 Leptin

M (76 species)

MCH Melanocyte Protein Magainin MAGE MART-1 Mastoparan Myelin

N (115 species)

Neurotrophic factor Neuromedin Neurokinin Neuropeptide Natriuretic peptide

O (773 species)

Obestatin OVA Oxytocin Orexin Others

P (129 species)

PACAP pTH Protease Activated Receptor Parathyroid Hormone PLP Procathepsin Pannexin Peptide YY Prolactin Pancreatic Polypeptide Probe

R (61 species)

RF amide Receptor RGD

S (187 species)

Substance P Salusin Saposin Sarafotoxin Secretin Somatostatin Substrate SH2 Domain Ligand

T (43 species)

TRH TNF Toxin B Tyrosinase Terlipressin

U (35 species)

Urocortin Urotensin

V (44 species)

VIP Vasopressin Valorphin

W (3 species)

Wwamide

X (3 species)

Xenopsin

Name Calcitonin, eel	Molecular structural formula
Purity ≥95%
CAS Number 57014-02-5
Formula C146H241N43O47S2
MW 3414.94
Target others
Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser- Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val- Gly-Ala-Gly-Thr-Pro-NH2(Disulfide bridge:Cys1-Cys7)
Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7)
InChIKey JDJALSWDQPEHEJ-UHFFFAOYSA-N
References [1]. Sortino MA, et al. Comparative effects of eel calcitonin, salmon calcitonin and [Asu1,7]eel calcitonin on hypophyseal and osteoblastic function. Gynecol Endocrinol. 1993 Jun;7(2):89-96.