Filters
Catalog peptides
Linker
Synthesis of unnatural amino acids and other blocks
GLP-1 (7-37)
Name
GLP-1 (7-37)
Molecular structural formula
Purity
≥98%
CAS Number
106612-94-6
Formula
C151H228N40O47
MW
3355.67
Target
GCGR
Sequence
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH (trifluoroacetate salt)
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Solubility in water
< 0.1 mg/mL
References
[1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004). [2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7.
* All products on our website are for scientific research and cannot be used in human body
Product details
Data download

Glucagon-like peptide-1, GLP-1) is a hormone mainly produced by intestinal L cells, belonging to incretin (incretin), glucagon-like peptide-1 receptor agonist (GLP-1RA) is a new hypoglycemic drug in recent years, by activating GLP-1 receptor, enhancing insulin secretion in a glucose concentration-dependent manner, inhibiting glucagon secretion, and can delay gastric emptying, reduce food intake through central appetite suppression, so as to achieve blood sugar, weight loss and other effects.