Filters
Catalog peptides
Linker
Synthesis of unnatural amino acids and other blocks
Ecallantide
Name
Ecallantide
Molecular structural formula
Purity
≥98%
CAS Number
460738-38-9
Formula
C305H442N88O91S8
MW
7053.81
Target
Ser/Thr Protease
Sequence
EAMHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD (Disulfide bond:Cys1-Cys6, Cys2-Cys4, Cys3-Cys5)
Sequence Shortening
Glu-Ala-Met-His-Ser-Phe-Cys-Ala-Phe-Lys-Ala-Asp-Asp-Gly-Pro-Cys-Arg-Ala-Ala-His-Pr o-Arg-Trp-Phe-Phe-Asn-Ile-Phe-Thr-Arg-Gln-Cys-Glu-Glu-Phe-Ile-Tyr-Gly-Gly-Cys-Glu_x005fGly-Asn-Gln-Asn-Arg-Phe-Glu-Ser-Leu-Glu-Glu-Cys-Lys-Lys-Met-Cys-Thr-Arg-Asp (Disu lfide bond:Cys1-Cys6, Cys2-Cys4, Cys3-Cys5)
InChIKey
VBGWSQKGUZHFPS-BRUBJIIKSA-N
References
[1]. Martello JL, et al. Ecallantide for treatment of acute attacks of hereditary angioedema. Am J Health Syst Pharm. 2012 Apr 15;69(8):651-7.
* All products on our website are for scientific research and cannot be used in human body
Product details
Data download

Ecallantide is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema.