Home / Peptide products / Cardiovascular / Nesiritide acetate
Filters
Catalog peptides
Linker
Synthesis of unnatural amino acids and other blocks
Nesiritide acetate
Name
Nesiritide acetate
Molecular structural formula
Purity
≥98%
CAS Number
114471-18-0
Formula
C143H244N50O42S4
MW
3464.04
Sequence
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Cys-Gly-Leu-Gly-Ser-Ser-Ser-Ser-Ile-Arg-Asp-Met-Lys-Lys-Val-Leu-Arg-Arg-His(Disulfide bridge: Cys10-Cys26)
Sequence Shortening
SPKMVQGSGCFGRCGLGSSSSIRDMKKVLRRH(Disulfide bridge: Cys10-Cys26)
InChIKey
FJULFJFRGUHITK-INJFIXSDSA-N
* All products on our website are for scientific research and cannot be used in human body
Product details
Data download

Nexiritide is a synthetic human brain natriuretic peptide (BNChemicalbookP) obtained from Escherichiacoli using recombinant DNA technology, and its effect is very similar to that of human BNP. It contains a 32-amino acid polypeptide linked by a disulfide bond between its l0th and 26th amino acids (both cysteine) to form a l7-amino acid ring. Nesiritide acts after binding to natriuretic peptide type A receptor and type B receptor. In addition to increasing cGMP production, nesirinotide can also reduce renin-angiotensin system (RAS) and sympathetic nerve activity; It has a definite dilating effect on arterioles and venules throughout the body; It can significantly reduce pulmonary capillary intercalation pressure and right atrial pressure J, and reduce cardiac preload in heart failure. Neciritide also significantly reduces total peripheral vascular resistance, thereby reducing cardiac afterload in heart failure; has the effect of increasing cardiac index, the mechanism of which is related to the reduction of cardiac afterload; It has a specific dilating effect on coronary arteries; It also has the effect of reducing myocardial oxygen consumption.