Filters
Catalog peptides
Linker
Synthesis of unnatural amino acids and other blocks
Semaglutide
Name
Semaglutide
Molecular structural formula
Purity
≥98%
CAS Number
910463-68-2
Formula
C187H291N45O59
MW
4113.64
Sequence
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
InChIKey
DLSWIYLPEUIQAV-CCUURXOWSA-N
Solubility in DMSO
5mg/mL
Solubility in water
50mg/mL
References
[1]. Marso SP, et al. Semaglutide and Cardiovascular Outcomes in Patients with Type 2 Diabetes. N Engl J Med. 2016 Nov 10;375(19):1834-1844. [2]. Zhang L, et al. Neuroprotective effects of the novel GLP-1 long acting analogue semaglutide in the MPTP Parkinson's disease mouse model. Neuropeptides. 2018 Oct;71:70-80. [3]. Dhillon S, et al. Semaglutide: First Global Approval. Drugs. 2018 Feb;78(2):275-284.
* All products on our website are for scientific research and cannot be used in human body
Product details
Data download

Semaglutide, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide has the potential for type 2 diabetes treatment.

Semaglutide is a polypeptide that contains a linear sequence of 31 amino acids joined together by peptide linkages. It is an agonist of glucagon-like peptide-1 receptors (GLP-1 AR) and used for the treatment of type 2 diabetes. It has a role as a hypoglycemic agent, a glucagon-like peptide-1 receptor agonist, an anti-obesity agent, a neuroprotective agent and an appetite depressant. It is a polypeptide and a lipopeptide.