Filters
Catalog peptides
Linker
Synthesis of unnatural amino acids and other blocks
Lixisenatide
Name
Lixisenatide
Molecular structural formula
Purity
≥98%
CAS Number
320367-13-3
Formula
C215H347N61O65S
MW
4858.5
Target
Amylin Receptor
Sequence
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-lle-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys
Sequence Shortening
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
InChIKey
XVVOERDUTLJJHN-IAEQDCLQSA-N
References
[1].Liu J, Li L, Deng K, Xu C, Busse JW, Vandvik PO, et al. (June 2017). [2]. Cai HY, Yang JT, Wang ZJ, Zhang J, Yang W, Wu MN, Qi JS (January 2018). "Lixisenatide reduces amyloid plaques, neurofibrillary tangles and neuroinflammation in an APP/PS1/tau mouse model of Alzheimer's disease". Biochemical and Biophysical Research Communications. 495 (1): 1034–1040.
* All products on our website are for scientific research and cannot be used in human body
Product details
Data download

Lixisenatide is used as adjunct to diet and exercise to treat type 2 diabetes. In the European Union, its use is limited to complementing insulin therapy. As of 2017 it is unclear if they affect a person's risk of death. It is provided in an autoinjector containing fourteen doses and is injected subcutaneously.

Lixisenatide should not be used for people who have problems with stomach emptying. Lixisenatide delays emptying of the stomach, which may change how quickly other drugs that are taken by mouth take effect.