Home / Peptide products / Diabetes mellitus / Pramlintide acetate
Filters
Catalog peptides
Linker
Synthesis of unnatural amino acids and other blocks
Pramlintide acetate
Name
Pramlintide acetate
Molecular structural formula
Purity
≥98%
CAS Number
196078-30-5
Formula
C171H269N51O53S2
MW
3951
Target
Amylin Receptor
Sequence
H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Sequence Shortening
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
InChIKey
NRKVKVQDUCJPIZ-MKAGXXMWSA-N
* All products on our website are for scientific research and cannot be used in human body
Product details
Data download

Pramlintide Acetate is the acetate salt form of pramlintide, a peptide analogue of human amylin with 3 proline substitutions at position 25, 28 and 29, with antihyperglycemic activity. By mimicking amylin, pramlintide slows gastric emptying, inhibits digestive secretions (gastric acid, pancreatic enzymes, and bile), reduces glucagon secretion, and increases satiety; all of these actions are mediated mostly by glucose-sensitive areas in the brain stem. The overall result is a decrease in blood glucose levels. The use of pramlintide may cause an increased risk of insulin-induced hypoglycemia.