Filters
Catalog peptides
Tumor Antigen Peptide (Customized)

Exenatide acetate

Name
Exenatide acetate
Molecular structural formula
CAS Number
141732-76-5
Formula
C184H282N50O60S
MW
4186.6
Sequence Shortening
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Purity
≥98%
Target
Amylin Receptor
* All products on our website are for scientific research and cannot be used in human body
Product details
Data download

Exenatide acetate is a polypeptide drug that simulates the mechanism of action of glucagon-like peptide-1 (GLP-1) hormone, promotes insulin secretion, inhibits glucagon release, and slows down gastric emptying, thereby effectively improving the control of blood sugar levels.